Class a: All alpha proteins [46456] (290 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein automated matches [254699] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255949] (3 PDB entries) |
Domain d3s1nf_: 3s1n F: [249278] Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1ne2, d3s1nh_, d3s1ni1, d3s1ni2, d3s1nj_, d3s1nk_, d3s1nl_ automated match to d1twff_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1n (more details), 3.1 Å
SCOPe Domain Sequences for d3s1nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1nf_ a.143.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki plvirrylpdgsfedwsveelivdl
Timeline for d3s1nf_: