Lineage for d3s1nk_ (3s1n K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958258Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2958296Protein automated matches [190337] (2 species)
    not a true protein
  7. 2958297Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries)
  8. 2958301Domain d3s1nk_: 3s1n K: [249283]
    Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1ne2, d3s1nf_, d3s1nh_, d3s1ni1, d3s1ni2, d3s1nj_, d3s1nl_
    automated match to d1twfk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1nk_

PDB Entry: 3s1n (more details), 3.1 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 2)
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d3s1nk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1nk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d3s1nk_:

Click to download the PDB-style file with coordinates for d3s1nk_.
(The format of our PDB-style files is described here.)

Timeline for d3s1nk_: