| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 automatically mapped to Pfam PF03870 |
| Protein RNA polymerase subunit RBP8 [50322] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries) Uniprot P20436 |
| Domain d3s1nh_: 3s1n H: [249279] Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1ne2, d3s1nf_, d3s1ni1, d3s1ni2, d3s1nj_, d3s1nk_, d3s1nl_ automated match to d1twfh_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1n (more details), 3.1 Å
SCOPe Domain Sequences for d3s1nh_:
Sequence, based on SEQRES records: (download)
>d3s1nh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr
>d3s1nh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr
Timeline for d3s1nh_: