SCOPe 2.07: Domain d3qa3f1: 3qa3 F:1-113

Lineage for d3qa3f1 (3qa3 F:1-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3qa3f1: 3qa3 F:1-113 [248817]
   Other proteins in same PDB: d3qa3a2, d3qa3c2, d3qa3e_, d3qa3f2, d3qa3g_, d3qa3i_, d3qa3j2, d3qa3l_
   complexed with ca, edo, gol

Details for d3qa3f1

PDB Entry: 3qa3, 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (F:) Antibody Light Chain

SCOPe Domain Sequences for d3qa3f1:

Sequence; same for both SEQRES and ATOM records:

>d3qa3f1 b.1.1.1 (F:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelk

Timeline for d3qa3f1:

• d3qa3f1 first appeared in SCOPe 2.04
  
• d3qa3f1 appears in SCOPe 2.06
  
• d3qa3f1 appears in the current release, SCOPe 2.08