| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
| Domain d3qa3c1: 3qa3 C:1-113 [248814] Other proteins in same PDB: d3qa3a2, d3qa3c2, d3qa3e_, d3qa3f2, d3qa3g_, d3qa3i_, d3qa3j2, d3qa3l_ complexed with ca, edo, gol |
PDB Entry: 3qa3 (more details), 3 Å
SCOPe Domain Sequences for d3qa3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qa3c1 b.1.1.1 (C:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelk
Timeline for d3qa3c1: