| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (17 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
| Domain d3qa3j2: 3qa3 J:114-220 [248822] Other proteins in same PDB: d3qa3a1, d3qa3c1, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3i_, d3qa3j1, d3qa3l_ complexed with ca, edo, gol |
PDB Entry: 3qa3 (more details), 3 Å
SCOPe Domain Sequences for d3qa3j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qa3j2 b.1.1.2 (J:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3qa3j2: