Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries) |
Domain d3q4dg1: 3q4d G:1-124 [248776] Other proteins in same PDB: d3q4da2, d3q4db2, d3q4dc2, d3q4dd2, d3q4de2, d3q4df2, d3q4dg2, d3q4dh2, d3q4di2 automated match to d2p8ba1 complexed with ala, dal, mg |
PDB Entry: 3q4d (more details), 3 Å
SCOPe Domain Sequences for d3q4dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q4dg1 d.54.1.0 (G:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya flgg
Timeline for d3q4dg1: