Lineage for d3q4df1 (3q4d F:1-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948167Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries)
  8. 2948173Domain d3q4df1: 3q4d F:1-124 [248774]
    Other proteins in same PDB: d3q4da2, d3q4db2, d3q4dc2, d3q4dd2, d3q4de2, d3q4df2, d3q4dg2, d3q4dh2, d3q4di2
    automated match to d2p8ba1
    complexed with ala, dal, mg

Details for d3q4df1

PDB Entry: 3q4d (more details), 3 Å

PDB Description: Crystal structure of dipeptide epimerase from Cytophaga hutchinsonii complexed with Mg and dipeptide D-Ala-L-Ala
PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q4df1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q4df1 d.54.1.0 (F:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
flgg

SCOPe Domain Coordinates for d3q4df1:

Click to download the PDB-style file with coordinates for d3q4df1.
(The format of our PDB-style files is described here.)

Timeline for d3q4df1: