SCOPe 2.08: Domain d3q4da1: 3q4d A:1-124

Lineage for d3q4da1 (3q4d A:1-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries)

8. Domain d3q4da1: 3q4d A:1-124 [248764]
   Other proteins in same PDB: d3q4da2, d3q4db2, d3q4dc2, d3q4dd2, d3q4de2, d3q4df2, d3q4dg2, d3q4dh2, d3q4di2
   automated match to d2p8ba1
   complexed with ala, dal, mg

Details for d3q4da1

PDB Entry: 3q4d, 3 Å

PDB Description: Crystal structure of dipeptide epimerase from Cytophaga hutchinsonii complexed with Mg and dipeptide D-Ala-L-Ala

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q4da1:

Sequence; same for both SEQRES and ATOM records:

>d3q4da1 d.54.1.0 (A:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
flgg

Timeline for d3q4da1:

• d3q4da1 first appeared in SCOPe 2.04
  
• d3q4da1 appears in SCOPe 2.07