Lineage for d3q3sa2 (3q3s A:95-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727859Protein Ethr repressor [109978] (2 species)
  7. 2727860Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. 2727868Domain d3q3sa2: 3q3s A:95-215 [248745]
    Other proteins in same PDB: d3q3sa1
    automated match to d3g1ma2
    protein/DNA complex; complexed with o8b

Details for d3q3sa2

PDB Entry: 3q3s (more details), 2 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM5683
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3q3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3sa2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

SCOPe Domain Coordinates for d3q3sa2:

Click to download the PDB-style file with coordinates for d3q3sa2.
(The format of our PDB-style files is described here.)

Timeline for d3q3sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q3sa1