Lineage for d3g1ma2 (3g1m A:95-215)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein automated matches [226970] (6 species)
not a true proteinSpecies Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries) 
Domain d3g1ma2: 3g1m A:95-215 [232229]
Other proteins in same PDB: d3g1ma1
automated match to d1t56a2
protein/DNA complex; complexed with rf3
Details for d3g1ma2
PDB Entry: 3g1m (more details), 1.7 Å
PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM31381
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethrSCOPe Domain Sequences for d3g1ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1ma2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n
SCOPe Domain Coordinates for d3g1ma2:
Click to download the PDB-style file with coordinates for d3g1ma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g1ma2:
- d3g1ma2 first appeared in SCOPe 2.03
- d3g1ma2 appears in SCOPe 2.07
View in 3D
