Lineage for d3g1ma2 (3g1m A:95-215)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280226Protein automated matches [226970] (3 species)
    not a true protein
  7. 1280238Species Mycobacterium tuberculosis [TaxId:1773] [232226] (4 PDB entries)
  8. 1280239Domain d3g1ma2: 3g1m A:95-215 [232229]
    Other proteins in same PDB: d3g1ma1
    automated match to d1t56a2
    protein/DNA complex; complexed with rf3

Details for d3g1ma2

PDB Entry: 3g1m (more details), 1.7 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM31381
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3g1ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g1ma2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

SCOPe Domain Coordinates for d3g1ma2:

Click to download the PDB-style file with coordinates for d3g1ma2.
(The format of our PDB-style files is described here.)

Timeline for d3g1ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g1ma1