![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries) |
![]() | Domain d3pwfa1: 3pwf A:2-134 [248701] Other proteins in same PDB: d3pwfa2, d3pwfb2 automated match to d3mpsa1 complexed with fe2 |
PDB Entry: 3pwf (more details), 1.64 Å
SCOPe Domain Sequences for d3pwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwfa1 a.25.1.1 (A:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]} vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely rkakekaekgedi
Timeline for d3pwfa1: