| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.0: automated matches [232942] (1 protein) not a true family |
| Protein automated matches [232943] (4 species) not a true protein |
| Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries) |
| Domain d3pwfb2: 3pwf B:135-171 [248704] Other proteins in same PDB: d3pwfa1, d3pwfb1 automated match to d3mpsa2 complexed with fe2 |
PDB Entry: 3pwf (more details), 1.64 Å
SCOPe Domain Sequences for d3pwfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwfb2 g.41.5.0 (B:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d3pwfb2: