Lineage for d3puyb2 (3puy B:236-369)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790190Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1790210Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 1790211Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 1790233Domain d3puyb2: 3puy B:236-369 [248661]
    Other proteins in same PDB: d3puya1, d3puyb1, d3puye_, d3puyf1, d3puyf2, d3puyg_
    automated match to d3puza2
    complexed with anp, mal, mg, pgv

Details for d3puyb2

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
PDB Compounds: (B:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puyb2:

Sequence, based on SEQRES records: (download)

>d3puyb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkep

Sequence, based on observed residues (ATOM records): (download)

>d3puyb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkataidqvqvelpmpnrqqvwlpvenmslgirpehllpsdiadvilegevq
vveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrl
hkep

SCOPe Domain Coordinates for d3puyb2:

Click to download the PDB-style file with coordinates for d3puyb2.
(The format of our PDB-style files is described here.)

Timeline for d3puyb2: