SCOPe 2.05: Domain d3puza2: 3puz A:236-371

Lineage for d3puza2 (3puz A:236-371)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.6: MOP-like [50331] (4 families)
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
probably stems out from the biMOP domain
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
Domain d3puza2: 3puz A:236-371 [200250]
Other proteins in same PDB: d3puza1, d3puzb1, d3puze_, d3puzf1, d3puzf2, d3puzg_
automated match to d1q12a1
complexed with anp, mal, mg, pgv

Details for d3puza2

PDB Entry: 3puz (more details), 2.9 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp

PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puza2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d3puza2:

Click to download the PDB-style file with coordinates for d3puza2.
(The format of our PDB-style files is described here.)

Timeline for d3puza2: