Lineage for d3puyf1 (3puy F:10-260)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1955034Fold e.70: MalF N-terminal region-like [160963] (1 superfamily)
    consists of 3 N-terminal transmembrane helices, an alpha+beta linker domain and a beta-barrel (n=7; S=8) with one overside loop
  4. 1955035Superfamily e.70.1: MalF N-terminal region-like [160964] (1 family) (S)
  5. 1955036Family e.70.1.1: MalF N-terminal region-like [160965] (1 protein)
    PfamB PB001917
  6. 1955037Protein Maltose transport system permease protein MalF [160966] (1 species)
  7. 1955038Species Escherichia coli [TaxId:562] [160967] (10 PDB entries)
    Uniprot P02916 13-260
  8. 1955045Domain d3puyf1: 3puy F:10-260 [248663]
    Other proteins in same PDB: d3puya1, d3puya2, d3puyb1, d3puyb2, d3puye_, d3puyf2, d3puyg_
    automated match to d2r6gf1
    complexed with anp, mal, mg, pgv

Details for d3puyf1

PDB Entry: 3puy (more details), 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
PDB Compounds: (F:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3puyf1:

Sequence, based on SEQRES records: (download)

>d3puyf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsitadgnwgde
klspgytvttg

Sequence, based on observed residues (ATOM records): (download)

>d3puyf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsinwgdeklsp
gytvttg

SCOPe Domain Coordinates for d3puyf1:

Click to download the PDB-style file with coordinates for d3puyf1.
(The format of our PDB-style files is described here.)

Timeline for d3puyf1: