SCOPe 2.05: Domain d3puya2: 3puy A:236-372

Lineage for d3puya2 (3puy A:236-372)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d3puya2: 3puy A:236-372 [248659]
   Other proteins in same PDB: d3puya1, d3puyb1, d3puye_, d3puyf1, d3puyf2, d3puyg_
   automated match to d3puza2
   complexed with anp, mal, mg, pgv

Details for d3puya2

PDB Entry: 3puy, 3.1 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state

PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puya2:

Sequence; same for both SEQRES and ATOM records:

>d3puya2 b.40.6.3 (A:236-372) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgva

Timeline for d3puya2:

• d3puya2 first appeared in SCOPe 2.04
  
• d3puya2 appears in SCOPe 2.06
  
• d3puya2 appears in the current release, SCOPe 2.08