Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins) |
Protein automated matches [232528] (2 species) not a true protein |
Species Rhodococcus sp. [TaxId:104109] [232529] (9 PDB entries) |
Domain d3puhb1: 3puh B:1-351 [248656] Other proteins in same PDB: d3puha2, d3puhb2 automated match to d3i2ja1 complexed with gol, so4 |
PDB Entry: 3puh (more details), 2.3 Å
SCOPe Domain Sequences for d3puhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puhb1 c.69.1.21 (B:1-351) automated matches {Rhodococcus sp. [TaxId: 104109]} mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsd arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw
Timeline for d3puhb1: