SCOPe 2.08: Domain d3puhb1: 3puh B:1-351

Lineage for d3puhb1 (3puh B:1-351)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)

6. Protein automated matches [232528] (2 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:104109] [232529] (10 PDB entries)

8. Domain d3puhb1: 3puh B:1-351 [248656]
   Other proteins in same PDB: d3puha2, d3puhb2
   automated match to d3i2ja1
   complexed with gol, so4

Details for d3puhb1

PDB Entry: 3puh, 2.3 Å

PDB Description: cocaine esterase, wild-type biologically active dimer

PDB Compounds: (B:) cocaine esterase

SCOPe Domain Sequences for d3puhb1:

Sequence; same for both SEQRES and ATOM records:

>d3puhb1 c.69.1.21 (B:1-351) automated matches {Rhodococcus sp. [TaxId: 104109]}
mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl
efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg
vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsd
arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl
ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg
iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

Timeline for d3puhb1:

• d3puhb1 first appeared in SCOPe 2.04
  
• d3puhb1 appears in SCOPe 2.07