![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Rhodococcus sp. [TaxId:104109] [232531] (10 PDB entries) |
![]() | Domain d3puhb2: 3puh B:352-574 [248657] Other proteins in same PDB: d3puha1, d3puhb1 automated match to d3i2ja2 complexed with gol, so4 |
PDB Entry: 3puh (more details), 2.3 Å
SCOPe Domain Sequences for d3puhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puhb2 b.18.1.0 (B:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]} plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk ydrnsntggviareqleemctavnrihrgpehpshivlpiikr
Timeline for d3puhb2: