SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3puha2 (3puh A:352-574)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039963Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2039964Protein automated matches [190770] (34 species)
    not a true protein
  7. 2040219Species Rhodococcus sp. [TaxId:104109] [232531] (9 PDB entries)
  8. 2040227Domain d3puha2: 3puh A:352-574 [248655]
    Other proteins in same PDB: d3puha1, d3puhb1
    automated match to d3i2ja2
    complexed with gol, so4

Details for d3puha2

PDB Entry: 3puh (more details), 2.3 Å

PDB Description: Cocaine Esterase, wild-type biologically active dimer
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3puha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puha2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

SCOPe Domain Coordinates for d3puha2:

Click to download the PDB-style file with coordinates for d3puha2.
(The format of our PDB-style files is described here.)

Timeline for d3puha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3puha1