SCOPe 2.04: Domain d3pfrc2: 3pfr C:139-447

Lineage for d3pfrc2 (3pfr C:139-447)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries)

8. Domain d3pfrc2: 3pfr C:139-447 [248492]
   Other proteins in same PDB: d3pfra1, d3pfrb1, d3pfrc1, d3pfrd1
   automated match to d3n6ha2
   complexed with gkr, mg

Details for d3pfrc2

PDB Entry: 3pfr, 1.9 Å

PDB Description: Crystal structure of D-Glucarate dehydratase related protein from Actinobacillus Succinogenes complexed with D-Glucarate

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3pfrc2:

Sequence; same for both SEQRES and ATOM records:

>d3pfrc2 c.1.11.0 (C:139-447) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvr

Timeline for d3pfrc2:

• d3pfrc2 is new in SCOPe 2.04-stable
  
• d3pfrc2 appears in SCOPe 2.05
  
• d3pfrc2 appears in the current release, SCOPe 2.08