Lineage for d3pfrc1 (3pfr C:7-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649268Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)
  8. 1649275Domain d3pfrc1: 3pfr C:7-138 [248491]
    Other proteins in same PDB: d3pfra2, d3pfrb2, d3pfrc2, d3pfrd2
    automated match to d3n6ha1
    complexed with gkr, mg

Details for d3pfrc1

PDB Entry: 3pfr (more details), 1.9 Å

PDB Description: Crystal structure of D-Glucarate dehydratase related protein from Actinobacillus Succinogenes complexed with D-Glucarate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3pfrc1:

Sequence, based on SEQRES records: (download)

>d3pfrc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg
qflgvpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d3pfrc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellg

SCOPe Domain Coordinates for d3pfrc1:

Click to download the PDB-style file with coordinates for d3pfrc1.
(The format of our PDB-style files is described here.)

Timeline for d3pfrc1: