Lineage for d3pfrc2 (3pfr C:139-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837254Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries)
  8. 2837257Domain d3pfrc2: 3pfr C:139-447 [248492]
    Other proteins in same PDB: d3pfra1, d3pfrb1, d3pfrc1, d3pfrd1
    automated match to d3n6ha2
    complexed with gkr, mg

Details for d3pfrc2

PDB Entry: 3pfr (more details), 1.9 Å

PDB Description: Crystal structure of D-Glucarate dehydratase related protein from Actinobacillus Succinogenes complexed with D-Glucarate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3pfrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfrc2 c.1.11.0 (C:139-447) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvr

SCOPe Domain Coordinates for d3pfrc2:

Click to download the PDB-style file with coordinates for d3pfrc2.
(The format of our PDB-style files is described here.)

Timeline for d3pfrc2: