SCOPe 2.04: Domain d3og2a4: 3og2 A:669-852

Lineage for d3og2a4 (3og2 A:669-852)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (24 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries)

8. Domain d3og2a4: 3og2 A:669-852 [248249]
   Other proteins in same PDB: d3og2a1, d3og2a2, d3og2a3
   automated match to d1tg7a2
   complexed with gol, nag

Details for d3og2a4

PDB Entry: 3og2, 1.2 Å

PDB Description: native crystal structure of trichoderma reesei beta-galactosidase

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3og2a4:

Sequence; same for both SEQRES and ATOM records:

>d3og2a4 b.18.1.0 (A:669-852) automated matches {Trichoderma reesei [TaxId: 51453]}
iphvqvpeltklkwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygf
hagtllfrgrftartarqqlflstqggsafassvwlndrfigsftgfdaasaanssytld
rlvrgrryiltvvvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlg
gedy

Timeline for d3og2a4:

• d3og2a4 is new in SCOPe 2.04-stable
  
• d3og2a4 appears in SCOPe 2.05
  
• d3og2a4 appears in the current release, SCOPe 2.08