Lineage for d3og2a4 (3og2 A:669-852)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775442Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries)
  8. 2775443Domain d3og2a4: 3og2 A:669-852 [248249]
    Other proteins in same PDB: d3og2a1, d3og2a2, d3og2a3
    automated match to d1tg7a2
    complexed with gol, nag

Details for d3og2a4

PDB Entry: 3og2 (more details), 1.2 Å

PDB Description: native crystal structure of trichoderma reesei beta-galactosidase
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3og2a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3og2a4 b.18.1.0 (A:669-852) automated matches {Trichoderma reesei [TaxId: 51453]}
iphvqvpeltklkwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygf
hagtllfrgrftartarqqlflstqggsafassvwlndrfigsftgfdaasaanssytld
rlvrgrryiltvvvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlg
gedy

SCOPe Domain Coordinates for d3og2a4:

Click to download the PDB-style file with coordinates for d3og2a4.
(The format of our PDB-style files is described here.)

Timeline for d3og2a4: