Lineage for d1d3ba_ (1d3b A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787019Protein D3 core SNRNP protein [50188] (3 species)
  7. 2787020Species Human (Homo sapiens) [TaxId:9606] [50189] (1 PDB entry)
  8. 2787021Domain d1d3ba_: 1d3b A: [24798]
    Other proteins in same PDB: d1d3bb_, d1d3bd_, d1d3bf_, d1d3bh_, d1d3bj_, d1d3bl_
    CASP3
    protein/RNA complex; complexed with cit, gol

Details for d1d3ba_

PDB Entry: 1d3b (more details), 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
PDB Compounds: (A:) protein (small nuclear ribonucleoprotein sm d3)

SCOPe Domain Sequences for d1d3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
gvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyi
rgckirflilpd

SCOPe Domain Coordinates for d1d3ba_:

Click to download the PDB-style file with coordinates for d1d3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1d3ba_: