PDB entry 1d3b

View 1d3b on RCSB PDB site
Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Class: RNA binding protein
Keywords: snrnp, splicing, sm, core snrnp domain, systemic lupus erythematosus, sle, RNA binding protein
Deposited on 1998-12-22, released 1999-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3ba_
  • Chain 'B':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bb_
  • Chain 'C':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3bc_
  • Chain 'D':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bd_
  • Chain 'E':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3be_
  • Chain 'F':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bf_
  • Chain 'G':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3bg_
  • Chain 'H':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bh_
  • Chain 'I':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3bi_
  • Chain 'J':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bj_
  • Chain 'K':
    Compound: protein (small nuclear ribonucleoprotein sm d3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62318 (Start-74)
      • mutation (65)
    Domains in SCOPe 2.07: d1d3bk_
  • Chain 'L':
    Compound: protein (small nuclear ribonucleoprotein associated protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3bl_
  • Heterogens: CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d3bA (A:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bA (A:)
    gvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyi
    rgckirflilpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d3bB (B:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bB (B:)
    skmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaereekrv
    lglvllrgenlvsmtvegppp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d3bC (C:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bC (C:)
    vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir
    gckirflilpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d3bD (D:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bD (D:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegppp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1d3bE (E:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bE (E:)
    sigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqv
    yirgckirflilpd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1d3bF (F:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bF (F:)
    ksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaereek
    rvlglvllrgenlvsmtvegppp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1d3bG (G:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bG (G:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgckirflilpd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1d3bH (H:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bH (H:)
    vgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaere
    ekrvlglvllrgenlvsmtvegpppk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1d3bI (I:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bI (I:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgckirflilpd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1d3bJ (J:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bJ (J:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegppp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1d3bK (K:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgckirflilpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bK (K:)
    vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir
    gckirflilpd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1d3bL (L:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3bL (L:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegpppkdtg