| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d3miab1: 3mia B:7-150 [247710] Other proteins in same PDB: d3miaa_ automated match to d2pk2a2 complexed with anp, mg, zn |
PDB Entry: 3mia (more details), 3 Å
SCOPe Domain Sequences for d3miab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3miab1 a.74.1.1 (B:7-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
lqqvqdlvilesiilqtlgfelti
Timeline for d3miab1: