SCOPe 2.08: Domain d3miab1: 3mia B:7-150

Lineage for d3miab1 (3mia B:7-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d3miab1: 3mia B:7-150 [247710]
   Other proteins in same PDB: d3miaa_
   automated match to d2pk2a2
   complexed with anp, mg, zn

Details for d3miab1

PDB Entry: 3mia, 3 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with ATP-bound human P-TEFb

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3miab1:

Sequence; same for both SEQRES and ATOM records:

>d3miab1 a.74.1.1 (B:7-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
lqqvqdlvilesiilqtlgfelti

Timeline for d3miab1:

• d3miab1 first appeared in SCOPe 2.04
  
• d3miab1 appears in SCOPe 2.07