Lineage for d3miab2 (3mia B:151-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2001266Protein automated matches [227027] (3 species)
    not a true protein
  7. 2001280Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries)
  8. 2001298Domain d3miab2: 3mia B:151-261 [247711]
    Other proteins in same PDB: d3miaa_
    automated match to d2pk2a1
    complexed with anp, mg, zn

Details for d3miab2

PDB Entry: 3mia (more details), 3 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with ATP-bound human P-TEFb
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3miab2:

Sequence, based on SEQRES records: (download)

>d3miab2 a.74.1.1 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwrac

Sequence, based on observed residues (ATOM records): (download)

>d3miab2 a.74.1.1 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlc

SCOPe Domain Coordinates for d3miab2:

Click to download the PDB-style file with coordinates for d3miab2.
(The format of our PDB-style files is described here.)

Timeline for d3miab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3miab1
View in 3D
Domains from other chains:
(mouse over for more information)
d3miaa_