SCOPe 2.08: Domain d3lxab1: 3lxa B:32-323

Lineage for d3lxab1 (3lxa B:32-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries)
   alpha-galactosidase A

8. Domain d3lxab1: 3lxa B:32-323 [247531]
   Other proteins in same PDB: d3lxaa2, d3lxab2
   automated match to d3hg3a1
   complexed with gla, nag
   missing some secondary structures that made up less than one-third of the common domain

Details for d3lxab1

PDB Entry: 3lxa, 3.04 Å

PDB Description: interconversion of human lysosomal enzyme specificities

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxab1:

Sequence; same for both SEQRES and ATOM records:

>d3lxab1 c.1.8.1 (B:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscswpaymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

Timeline for d3lxab1:

• d3lxab1 first appeared in SCOPe 2.04
  
• d3lxab1 appears in SCOPe 2.07