SCOPe 2.08: Domain d3lxaa2: 3lxa A:324-426

Lineage for d3lxaa2 (3lxa A:324-426)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
   alpha-galactosidase A

8. Domain d3lxaa2: 3lxa A:324-426 [247530]
   Other proteins in same PDB: d3lxaa1, d3lxab1
   automated match to d3hg3a2
   complexed with gla, nag

Details for d3lxaa2

PDB Entry: 3lxa, 3.04 Å

PDB Description: interconversion of human lysosomal enzyme specificities

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxaa2:

Sequence; same for both SEQRES and ATOM records:

>d3lxaa2 b.71.1.1 (A:324-426) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmqmslk

Timeline for d3lxaa2:

• d3lxaa2 first appeared in SCOPe 2.04
  
• d3lxaa2 appears in SCOPe 2.07