Lineage for d3lxaa2 (3lxa A:324-426)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555976Protein Melibiase [75020] (4 species)
  7. 1555980Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 1556005Domain d3lxaa2: 3lxa A:324-426 [247530]
    Other proteins in same PDB: d3lxaa1, d3lxab1
    automated match to d3hg3a2
    complexed with gla, nag

Details for d3lxaa2

PDB Entry: 3lxa (more details), 3.04 Å

PDB Description: interconversion of human lysosomal enzyme specificities
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxaa2 b.71.1.1 (A:324-426) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmqmslk

SCOPe Domain Coordinates for d3lxaa2:

Click to download the PDB-style file with coordinates for d3lxaa2.
(The format of our PDB-style files is described here.)

Timeline for d3lxaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lxaa1