Lineage for d3lp8a3 (3lp8 A:325-419)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560355Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1560356Protein automated matches [254496] (10 species)
    not a true protein
  7. 1560367Species Ehrlichia chaffeensis [TaxId:205920] [255936] (1 PDB entry)
  8. 1560368Domain d3lp8a3: 3lp8 A:325-419 [247485]
    Other proteins in same PDB: d3lp8a1, d3lp8a2
    automated match to d1gsoa1
    complexed with po4, unx

Details for d3lp8a3

PDB Entry: 3lp8 (more details), 2.15 Å

PDB Description: Crystal structure of phosphoribosylamine-glycine ligase from Ehrlichia chaffeensis
PDB Compounds: (A:) Phosphoribosylamine-glycine ligase

SCOPe Domain Sequences for d3lp8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lp8a3 b.84.2.0 (A:325-419) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
kkaalcvvvasrgypgeykknsiingienieklpnvqllhagtrregnnwvsdsgrvinv
vaqgenlasakhqayaaldlldwpdgiyrydigsc

SCOPe Domain Coordinates for d3lp8a3:

Click to download the PDB-style file with coordinates for d3lp8a3.
(The format of our PDB-style files is described here.)

Timeline for d3lp8a3: