| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (11 species) not a true protein |
| Species Ehrlichia chaffeensis [TaxId:205920] [255936] (1 PDB entry) |
| Domain d3lp8a3: 3lp8 A:325-419 [247485] Other proteins in same PDB: d3lp8a1, d3lp8a2 automated match to d1gsoa1 complexed with po4, unx |
PDB Entry: 3lp8 (more details), 2.15 Å
SCOPe Domain Sequences for d3lp8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lp8a3 b.84.2.0 (A:325-419) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
kkaalcvvvasrgypgeykknsiingienieklpnvqllhagtrregnnwvsdsgrvinv
vaqgenlasakhqayaaldlldwpdgiyrydigsc
Timeline for d3lp8a3: