SCOPe 2.04: Domain d3lp8a2: 3lp8 A:102-324

Lineage for d3lp8a2 (3lp8 A:102-324)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (25 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [255935] (1 PDB entry)

8. Domain d3lp8a2: 3lp8 A:102-324 [247484]
   Other proteins in same PDB: d3lp8a1, d3lp8a3
   automated match to d1gsoa3
   complexed with po4, unx

Details for d3lp8a2

PDB Entry: 3lp8, 2.15 Å

PDB Description: Crystal structure of phosphoribosylamine-glycine ligase from Ehrlichia chaffeensis

PDB Compounds: (A:) Phosphoribosylamine-glycine ligase

SCOPe Domain Sequences for d3lp8a2:

Sequence; same for both SEQRES and ATOM records:

>d3lp8a2 d.142.1.0 (A:102-324) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
skgftkelcmrygiptakygyfvdtnsaykfidkhklplvvkadglaqgkgtvichthee
aynavdamlvhhkfgeagcaiiieeflegkeisfftlvdgsnpvilgvaqdyktigdnnk
gpntggmgsyskpniitqemehiiiqkiiyptikamfnmniqfrgllfagiiikknepkl
leynvrfgdpetqsilprlnsdflkllsltakgklgnesvels

Timeline for d3lp8a2:

• d3lp8a2 is new in SCOPe 2.04-stable
  
• d3lp8a2 appears in SCOPe 2.05
  
• d3lp8a2 appears in the current release, SCOPe 2.08