| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
| Protein automated matches [226904] (39 species) not a true protein |
| Species Ehrlichia chaffeensis [TaxId:205920] [255935] (1 PDB entry) |
| Domain d3lp8a2: 3lp8 A:102-324 [247484] Other proteins in same PDB: d3lp8a1, d3lp8a3, d3lp8a4 automated match to d1gsoa3 complexed with po4, unx |
PDB Entry: 3lp8 (more details), 2.15 Å
SCOPe Domain Sequences for d3lp8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lp8a2 d.142.1.0 (A:102-324) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
skgftkelcmrygiptakygyfvdtnsaykfidkhklplvvkadglaqgkgtvichthee
aynavdamlvhhkfgeagcaiiieeflegkeisfftlvdgsnpvilgvaqdyktigdnnk
gpntggmgsyskpniitqemehiiiqkiiyptikamfnmniqfrgllfagiiikknepkl
leynvrfgdpetqsilprlnsdflkllsltakgklgnesvels
Timeline for d3lp8a2: