Lineage for d3l17a3 (3l17 A:525-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006533Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2006534Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2006535Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries)
  8. 2006577Domain d3l17a3: 3l17 A:525-725 [247321]
    Other proteins in same PDB: d3l17a1, d3l17a2, d3l17a4, d3l17a5
    automated match to d1e7ua1
    complexed with jzy

Details for d3l17a3

PDB Entry: 3l17 (more details), 3 Å

PDB Description: discovery of (thienopyrimidin-2-yl)aminopyrimidines as potent, selective, and orally available pan-pi3-kinase and dual pan-pi3- kinase/mtor inhibitors for the treatment of cancer
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3l17a3:

Sequence, based on SEQRES records: (download)

>d3l17a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3l17a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d3l17a3:

Click to download the PDB-style file with coordinates for d3l17a3.
(The format of our PDB-style files is described here.)

Timeline for d3l17a3: