Lineage for d3l17a4 (3l17 A:726-1091)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542186Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2542190Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2542191Species Human (Homo sapiens) [TaxId:9606] [56174] (72 PDB entries)
  8. 2542257Domain d3l17a4: 3l17 A:726-1091 [247322]
    Other proteins in same PDB: d3l17a1, d3l17a2, d3l17a3, d3l17a5
    automated match to d1e7ua4
    complexed with jzy

Details for d3l17a4

PDB Entry: 3l17 (more details), 3 Å

PDB Description: discovery of (thienopyrimidin-2-yl)aminopyrimidines as potent, selective, and orally available pan-pi3-kinase and dual pan-pi3- kinase/mtor inhibitors for the treatment of cancer
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3l17a4:

Sequence, based on SEQRES records: (download)

>d3l17a4 d.144.1.4 (A:726-1091) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlv

Sequence, based on observed residues (ATOM records): (download)

>d3l17a4 d.144.1.4 (A:726-1091) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv

SCOPe Domain Coordinates for d3l17a4:

Click to download the PDB-style file with coordinates for d3l17a4.
(The format of our PDB-style files is described here.)

Timeline for d3l17a4: