![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein automated matches [190916] (13 species) not a true protein |
![]() | Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) |
![]() | Domain d3km2s_: 3km2 S: [247235] automated match to d3hoga_ complexed with zn |
PDB Entry: 3km2 (more details), 3.1 Å
SCOPe Domain Sequences for d3km2s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3km2s_ b.1.8.1 (S:) automated matches {Solanum lycopersicum [TaxId: 4081]} atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh eleddlgkgghelslttgnaggrlacgvvgltp
Timeline for d3km2s_: