Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (13 species) not a true protein |
Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) |
Domain d3km2a_: 3km2 A: [247217] automated match to d3hoga_ complexed with zn |
PDB Entry: 3km2 (more details), 3.1 Å
SCOPe Domain Sequences for d3km2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3km2a_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]} atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh eleddlgkgghelslttgnaggrlacgvvgltp
Timeline for d3km2a_: