| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein automated matches [190916] (13 species) not a true protein |
| Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) |
| Domain d3km2e_: 3km2 E: [247221] automated match to d3hoga_ complexed with zn |
PDB Entry: 3km2 (more details), 3.1 Å
SCOPe Domain Sequences for d3km2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3km2e_ b.1.8.1 (E:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltp
Timeline for d3km2e_: