Class g: Small proteins [56992] (98 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein TGF-beta type II receptor extracellular domain [69951] (2 species) elaborated with additional structures resulting in a beta-sandwich fold |
Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries) |
Domain d3kfdh_: 3kfd H: [247157] Other proteins in same PDB: d3kfda_, d3kfdb_, d3kfdc_, d3kfdd_ automated match to d1ploa_ |
PDB Entry: 3kfd (more details), 3 Å
SCOPe Domain Sequences for d3kfdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kfdh_ g.7.1.3 (H:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniif
Timeline for d3kfdh_: