Lineage for d3kfde_ (3kfd E:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637152Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 2637155Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 2637161Domain d3kfde_: 3kfd E: [247154]
    Other proteins in same PDB: d3kfda_, d3kfdb_, d3kfdc_, d3kfdd_
    automated match to d1ploa_

Details for d3kfde_

PDB Entry: 3kfd (more details), 3 Å

PDB Description: Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
PDB Compounds: (E:) TGF-beta receptor type-2

SCOPe Domain Sequences for d3kfde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfde_ g.7.1.3 (E:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd
pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifse

SCOPe Domain Coordinates for d3kfde_:

Click to download the PDB-style file with coordinates for d3kfde_.
(The format of our PDB-style files is described here.)

Timeline for d3kfde_: