SCOPe 2.04: Domain d3kfdh_: 3kfd H:

Lineage for d3kfdh_ (3kfd H:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
   elaborated with additional structures resulting in a beta-sandwich fold

7. Species Human (Homo sapiens) [TaxId:9606] [69952] (5 PDB entries)

8. Domain d3kfdh_: 3kfd H: [247157]
   Other proteins in same PDB: d3kfda_, d3kfdb_, d3kfdc_, d3kfdd_
   automated match to d1ploa_

Details for d3kfdh_

PDB Entry: 3kfd, 3 Å

PDB Description: Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily

PDB Compounds: (H:) TGF-beta receptor type-2

SCOPe Domain Sequences for d3kfdh_:

Sequence; same for both SEQRES and ATOM records:

>d3kfdh_ g.7.1.3 (H:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd
pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniif

Timeline for d3kfdh_:

• d3kfdh_ is new in SCOPe 2.04-stable
  
• d3kfdh_ appears in SCOPe 2.05
  
• d3kfdh_ appears in the current release, SCOPe 2.08