SCOP 1.63: Domain d1hszb1: 1hsz B:1-174,B:325-374

Lineage for d1hszb1 (1hsz B:1-174,B:325-374)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (6 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (5 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (17 PDB entries)

8. Domain d1hszb1: 1hsz B:1-174,B:325-374 [24712]
   Other proteins in same PDB: d1hsza2, d1hszb2
   beta-1 isozyme
   complexed with nad, po4, zn

Details for d1hszb1

PDB Entry: 1hsz, 2.2 Å

PDB Description: human beta-1 alcohol dehydrogenase (adh1b*1)

SCOP Domain Sequences for d1hszb1:

Sequence; same for both SEQRES and ATOM records:

>d1hszb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksirtvltf

Timeline for d1hszb1:

• d1hszb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hszb1 appears in SCOP 1.61
  
• d1hszb1 appears in SCOP 1.65
  
• d1hszb1 appears in the current release, SCOPe 2.08