| Class b: All beta proteins [48724] (180 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
| Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries) Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
| Domain d1hszb1: 1hsz B:1-162,B:339-374 [24712] Other proteins in same PDB: d1hsza2, d1hszb2 beta-1 isozyme complexed with nad, po4, zn |
PDB Entry: 1hsz (more details), 2.2 Å
SCOPe Domain Sequences for d1hszb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hszb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf
Timeline for d1hszb1: