Lineage for d1hszb1 (1hsz B:1-162,B:339-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785641Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2785669Domain d1hszb1: 1hsz B:1-162,B:339-374 [24712]
    Other proteins in same PDB: d1hsza2, d1hszb2
    beta-1 isozyme
    complexed with nad, po4, zn

Details for d1hszb1

PDB Entry: 1hsz (more details), 2.2 Å

PDB Description: human beta-1 alcohol dehydrogenase (adh1b*1)
PDB Compounds: (B:) class I alcohol dehydrogenase 1, beta subunit

SCOPe Domain Sequences for d1hszb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hszb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

SCOPe Domain Coordinates for d1hszb1:

Click to download the PDB-style file with coordinates for d1hszb1.
(The format of our PDB-style files is described here.)

Timeline for d1hszb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hszb2