Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
Protein automated matches [233857] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
Domain d3ijea3: 3ije A:599-737 [246918] Other proteins in same PDB: d3ijea1 automated match to d1m1xa2 complexed with ca, nag |
PDB Entry: 3ije (more details), 2.9 Å
SCOPe Domain Sequences for d3ijea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijea3 b.1.15.0 (A:599-737) automated matches {Human (Homo sapiens) [TaxId: 9606]} dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq ssnlfdkvspvvshkvdla
Timeline for d3ijea3: