![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) ![]() |
![]() | Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
![]() | Protein automated matches [254690] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255892] (14 PDB entries) |
![]() | Domain d3ijea1: 3ije A:1-438 [246916] Other proteins in same PDB: d3ijea2, d3ijea3, d3ijea4 automated match to d1m1xa4 complexed with ca, nag |
PDB Entry: 3ije (more details), 2.9 Å
SCOPe Domain Sequences for d3ijea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijea1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp dlivgafgvdrailyrar
Timeline for d3ijea1: