Lineage for d3ijea1 (3ije A:1-438)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809519Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2809520Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2809563Protein automated matches [254690] (1 species)
    not a true protein
  7. 2809564Species Human (Homo sapiens) [TaxId:9606] [255892] (14 PDB entries)
  8. 2809575Domain d3ijea1: 3ije A:1-438 [246916]
    Other proteins in same PDB: d3ijea2, d3ijea3, d3ijea4
    automated match to d1m1xa4
    complexed with ca, nag

Details for d3ijea1

PDB Entry: 3ije (more details), 2.9 Å

PDB Description: crystal structure of the complete integrin alhavbeta3 ectodomain plus an alpha/beta transmembrane fragment
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d3ijea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijea1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d3ijea1:

Click to download the PDB-style file with coordinates for d3ijea1.
(The format of our PDB-style files is described here.)

Timeline for d3ijea1: